Click to Zoom

Anti-Cops2

From £421.12 per (ex VAT)

Anti-Cops2

Product Code HPA016867-100UL
Unit of Measure 1X100UL
Synonyms Anti-Alien Homolog; Anti-Cop9 Signalosome Complex Subunit 2; Anti-Jab1-Containing Signalosome Subunit 2; Anti-Sgn2; Anti-Signalosome Subunit 2; Anti-Trip-15; Anti-Thyroid Receptor-Interacting Protein 15
Brand SIGMA-ALDRICH

Tiered Pricing - HPA016867-100UL

Qty Discount Price
4+ 5% £425.60
12+ 6% £421.12
SKU - Pack Size Availability Price (ex VAT) Qty
HPA016867-100UL Please check stock availability Check Availability £0.00 per EA £448.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms Anti-Alien homolog; Anti-COP9 signalosome complex subunit 2; Anti-JAB1-containing signalosome subunit 2; Anti-SGN2; Anti-Signalosome subunit 2; Anti-TRIP-15; Anti-Thyroid receptor-interacting protein 15
Tariff Number 30021500900
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
enhanced validation recombinant expressionLearn more about Antibody Enhanced Validation
technique(s) immunohistochemistry: 1:20-1:50
storage temp. -20C
Quality Level 100
shipped in wet ice
Antibody Product Type primary antibodies
biological source rabbit
conjugate unconjugated
form buffered aqueous glycerol solution
species reactivity human
Gene Information human ... COPS2(9318)
UniProt accession no. P61201
immunogen sequence KSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMT

Description

Anti-Cops2

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA