Click to Zoom

Anti-Galnt2

From £203.98 per (ex VAT)

Anti-Galnt2

Product Code HPA011222-25UL
Unit of Measure 1X25UL
Synonyms Anti-Galnac-T2; Anti-Polypeptide Galnac Transferase 2; Anti-Polypeptide N-Acetylgalactosaminyltransferase 2; Anti-Protein-Udp Acetylgalactosaminyltransferase 2; Anti-Udp- Galnac:Polypeptide N-Acetylgalactosaminyltransferase 2; Anti-Pp-Gantase 2
Brand SIGMA-ALDRICH

Tiered Pricing - HPA011222-25UL

Qty Discount Price
4+ 5% £206.15
12+ 6% £203.98
SKU - Pack Size Availability Price (ex VAT) Qty
HPA011222-100UL Anti-Galnt2 Please check stock availability Check Availability £456.00
HPA011222-25UL Please check stock availability Check Availability £0.00 per EA £217.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE DICE
UNSPSC Code 12350000
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 25
Synonyms Anti-GalNAc-T2; Anti-Polypeptide GalNAc transferase 2; Anti-Polypeptide N-acetylgalactosaminyltransferase 2; Anti-Protein-UDP acetylgalactosaminyltransferase 2; Anti-UDP- GalNAc:polypeptide N-acetylgalactosaminyltransferase 2; Anti-pp-GaNTase 2
Tariff Number 30021500900
Gene Information human ... GALNT2(2590)
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
UniProt accession no. Q10471
packaging antibody small pack of 25 muL
immunogen sequence SCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL
technique(s) immunofluorescence: 0.25-2 mug/mL
storage temp. -20C
Quality Level 100
shipped in wet ice
Antibody Product Type primary antibodies
biological source rabbit
conjugate unconjugated
form buffered aqueous glycerol solution
species reactivity human

Description

Anti-Galnt2

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA