Click to Zoom

Anti-Rffl

From £454.96 per (ex VAT)

Anti-Rffl

Product Code HPA017910-100UL
Unit of Measure 1X100UL
Synonyms Anti-Carp-2; Anti-Caspase Regulator Carp2; Anti-Caspases-8 And -10-Associated Ring Finger Protein 2; Anti-E3 Ubiquitin-Protein Ligase Rififylin; Anti-Fyve-Ring Finger Protein Sakura; Anti-Fring; Anti-Ring Finger And Fyve-Like Domain-Containing Protein 1
Brand SIGMA-ALDRICH

Tiered Pricing - HPA017910-100UL

Qty Discount Price
4+ 5% £459.80
12+ 6% £454.96
SKU - Pack Size Availability Price (ex VAT) Qty
HPA017910-100UL Please check stock availability Check Availability £0.00 per EA £484.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms Anti-CARP-2; Anti-Caspase regulator CARP2; Anti-Caspases-8 and -10-associated RING finger protein 2; Anti-E3 ubiquitin-protein ligase rififylin; Anti-FYVE-RING finger protein Sakura; Anti-Fring; Anti-RING finger and FYVE-like domain-containing protein 1
Tariff Number 30021500900
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
enhanced validation recombinant expressionLearn more about Antibody Enhanced Validation
technique(s) immunofluorescence: 0.25-2 mug/mL
immunogen sequence AQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNF
storage temp. -20C
Quality Level 100
shipped in wet ice
Antibody Product Type primary antibodies
biological source rabbit
conjugate unconjugated
form buffered aqueous glycerol solution
UniProt accession no. Q8WZ73
Gene Information human ... RFFL(117584)
species reactivity human

Description

Anti-Rffl

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA