Click to Zoom

Anti-Stag2

From £454.96 per (ex VAT)

Anti-Stag2

Product Code HPA002857-100UL
Unit of Measure 1X100UL
Synonyms Anti-Cohesin Subunit Sa-2 Antibody Produced In Rabbit; Anti-Scc3 Homolog 2 Antibody Produced In Rabbit; Anti-Stromal Antigen 2 Antibody Produced In Rabbit
Brand SIGMA-ALDRICH

Tiered Pricing - HPA002857-100UL

Qty Discount Price
4+ 5% £459.80
12+ 6% £454.96
SKU - Pack Size Availability Price (ex VAT) Qty
HPA002857-25UL Anti-Stag2 Please check stock availability Check Availability £0.00
HPA002857-100UL Please check stock availability Check Availability £0.00 per EA £484.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms Anti-Cohesin subunit SA-2 antibody produced in rabbit; Anti-SCC3 homolog 2 antibody produced in rabbit; Anti-Stromal antigen 2 antibody produced in rabbit
Tariff Number 30021500900
UniProt accession no. Q8N3U4
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
Gene Information human ... STAG2(10735)
packaging antibody small pack of 25 muL
storage temp. -20C
Quality Level 100
shipped in wet ice
Antibody Product Type primary antibodies
technique(s) immunohistochemistry: 1:200- 1:500
immunogen sequence LTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGE
biological source rabbit
conjugate unconjugated
form buffered aqueous glycerol solution
species reactivity human

Description

Anti-Stag2

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA