Click to Zoom

Anti-Tff1

From £203.98 per (ex VAT)

Anti-Tff1

Product Code HPA003425-25UL
Unit of Measure 1X25UL
Synonyms Anti-Breast Cancer Estrogen-Inducible Protein; Anti-Hp1A; Anti-Pnr-2; Anti-Trefoil Factor 1 Precursor; Anti-Ps2 Protein
Brand SIGMA-ALDRICH

Tiered Pricing - HPA003425-25UL

Qty Discount Price
4+ 5% £206.15
12+ 6% £203.98
SKU - Pack Size Availability Price (ex VAT) Qty
HPA003425-100UL Anti-Tff1 Please check stock availability Check Availability £456.00
HPA003425-25UL Please check stock availability Check Availability £0.00 per EA £217.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE DICE
UNSPSC Code 12350000
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 25
Synonyms Anti-Breast cancer estrogen-inducible protein; Anti-HP1A; Anti-PNR-2; Anti-Trefoil factor 1 precursor; Anti-pS2 protein
Tariff Number 30021500900
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
packaging antibody small pack of 25 muL
Gene Information human ... TFF1(7031)
storage temp. -20C
Quality Level 100
shipped in wet ice
Antibody Product Type primary antibodies
technique(s) immunohistochemistry: 1:1000-1:2500
biological source rabbit
conjugate unconjugated
immunogen sequence QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE
UniProt accession no. P04155
form buffered aqueous glycerol solution
species reactivity human
enhanced validation recombinant expressionorthogonal RNAseqLearn more about Antibody Enhanced Validation

Description

Anti-Tff1

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA