Click to Zoom

Prest Antigen Eid1

From £219.02 per (ex VAT)

Prest Antigen Eid1

Product Code APREST81561-100UL
Unit of Measure 1X100UL
Synonyms C15Orf3; Cri1; Eid-1
Brand SIGMA-ALDRICH

Tiered Pricing - APREST81561-100UL

Qty Discount Price
4+ 5% £221.35
12+ 6% £219.02
SKU - Pack Size Availability Price (ex VAT) Qty
APREST81561-100UL Please check stock availability Check Availability £0.00 per EA £233.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms C15orf3; CRI1; EID-1
Tariff Number 30029090900
mol wt predicted mol wt 28 kDa
concentration >=0.5 mg/mL
UniProt accession no. Q9Y6B2
purified by immobilized metal affinity chromatography (IMAC)
storage temp. -20C
Quality Level 100
shipped in wet ice
recombinant expressed in E. coli
Ensembl | human accession no. ENSG00000255302
immunogen sequence MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESED
Gene Information human ... EID1(23741)
form buffered aqueous solution
Assay >80% (SDS-PAGE)

Description

Prest Antigen Eid1

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA