Anti-Rp11-35N6.1 Antibody Produced In R
From £454.96 per (ex VAT)
Anti-Rp11-35N6.1 Antibody Produced In R
Product Code | HPA014968-100UL |
---|---|
Unit of Measure | 1X100UL |
Synonyms | Anti-Flj20300; Anti-Lppr1; Anti-Mgc26189; Anti-Prg-3 |
Brand | SIGMA-ALDRICH |
Tiered Pricing - HPA014968-100UL
Qty | Discount | Price |
---|---|---|
4+ | 5% | £459.80 |
12+ | 6% | £454.96 |
Properties
Property | Value |
---|---|
eCl@ss | 32160000 |
Shipped on ICE | WICE |
UNSPSC Code | 12350000 |
ADRSuff | 1 |
Storage Temperature | -20C |
Flash Point | Not applicable |
GHS Categories | NH |
GHS Hazard Codes | NH |
GHS Hazard Statements | NH |
GHS Pictograms | - |
GHS Precaution Codes | - |
GHS Signal Words | - |
Net Weight | 100 |
Synonyms | Anti-FLJ20300; Anti-LPPR1; Anti-MGC26189; Anti-PRG-3 |
Tariff Number | 30021500900 |
clone | polyclonal |
Antibody Form | affinity isolated antibody |
product line | Prestige Antibodies(R) Powered by Atlas Antibodies |
Gene Information | human ... PLPPR1(54886) |
immunogen sequence | KSTRESLIAQEKTILTGECCYLNPLLRRIIRF |
packaging | antibody small pack of 25 muL |
storage temp. | -20C |
Quality Level | 100 |
shipped in | wet ice |
Antibody Product Type | primary antibodies |
biological source | rabbit |
conjugate | unconjugated |
technique(s) | immunohistochemistry: 1:50- 1:200 |
form | buffered aqueous glycerol solution |
species reactivity | human |
Description
Anti-Rp11-35N6.1 Antibody Produced In R