Anti-Cd276
From £421.12 per (ex VAT)
Anti-Cd276
Product Code | HPA009285-100UL |
---|---|
Unit of Measure | 1X100UL |
Synonyms | Anti-4Ig-B7-H3 Antibody Produced In Rabbit; Anti-B7 Homolog 3 Antibody Produced In Rabbit; Anti-B7-H3 Antibody Produced In Rabbit; Anti-Cd276 Antigen Precursor Antibody Produced In Rabbit; Anti-Costimulatory Molecule Antibody Produced In Rabbit |
Brand | SIGMA-ALDRICH |
Tiered Pricing - HPA009285-100UL
Qty | Discount | Price |
---|---|---|
4+ | 5% | £425.60 |
12+ | 6% | £421.12 |
Properties
Property | Value |
---|---|
eCl@ss | 32160000 |
Shipped on ICE | WICE |
UNSPSC Code | 12350000 |
ADRSuff | 1 |
Storage Temperature | -20C |
Flash Point | Not applicable |
GHS Categories | NH |
GHS Hazard Codes | NH |
GHS Hazard Statements | NH |
GHS Pictograms | - |
GHS Precaution Codes | - |
GHS Signal Words | - |
Net Weight | 100 |
Synonyms | Anti-4Ig-B7-H3 antibody produced in rabbit; Anti-B7 homolog 3 antibody produced in rabbit; Anti-B7-H3 antibody produced in rabbit; Anti-CD276 antigen precursor antibody produced in rabbit; Anti-Costimulatory molecule antibody produced in rabbit |
Tariff Number | 30021500900 |
clone | polyclonal |
Antibody Form | affinity isolated antibody |
product line | Prestige Antibodies(R) Powered by Atlas Antibodies |
packaging | antibody small pack of 25 muL |
Gene Information | human ... CD276(80381) |
enhanced validation | orthogonal RNAseqrecombinant expressionLearn more about Antibody Enhanced Validation |
immunogen sequence | YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP |
technique(s) | immunohistochemistry: 1:20-1:50 |
storage temp. | -20C |
UniProt accession no. | Q5ZPR3 |
Quality Level | 100 |
shipped in | wet ice |
Antibody Product Type | primary antibodies |
biological source | rabbit |
conjugate | unconjugated |
form | buffered aqueous glycerol solution |
species reactivity | human |
Description
Anti-Cd276