Click to Zoom

Anti-Dpep1

From £421.12 per (ex VAT)

Anti-Dpep1

Product Code HPA009426-100UL
Unit of Measure 1X100UL
Synonyms Anti-Dehydropeptidase-I; Anti-Dipeptidase 1 Precursor; Anti-Microsomal Dipeptidase; Anti-Renal Dipeptidase; Anti-Hrdp
Brand SIGMA-ALDRICH

Tiered Pricing - HPA009426-100UL

Qty Discount Price
4+ 5% £425.60
12+ 6% £421.12
SKU - Pack Size Availability Price (ex VAT) Qty
HPA009426-25UL Anti-Dpep1 Please check stock availability Check Availability £217.00
HPA009426-100UL Please check stock availability Check Availability £0.00 per EA £448.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms Anti-Dehydropeptidase-I; Anti-Dipeptidase 1 precursor; Anti-Microsomal dipeptidase; Anti-Renal dipeptidase; Anti-hRDP
Tariff Number 30021500900
clone polyclonal
enhanced validation orthogonal RNAseqindependentrecombinant expressionLearn more about Antibody Enhanced Validation
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
packaging antibody small pack of 25 muL
technique(s) western blot: 0.04-0.4 mug/mL
storage temp. -20C
Quality Level 100
shipped in wet ice
Antibody Product Type primary antibodies
biological source rabbit
conjugate unconjugated
UniProt accession no. P16444
immunogen sequence VMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFQAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGAS
form buffered aqueous glycerol solution
species reactivity human
Gene Information human ... DPEP1(1800)

Description

Anti-Dpep1

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA