Anti-Mapk3
From £403.26 per (ex VAT)
Anti-Mapk3
Product Code | HPA003995-100UL |
---|---|
Unit of Measure | 1X100UL |
MDL NUMBER | MFCD02179320 |
Synonyms | Anti-Erk-1 Antibody Produced In Rabbit; Anti-Ert2 Antibody Produced In Rabbit; Anti-Extracellular Signal-Regulated Kinase 1 Antibody Produced In Rabbit; Anti-Insulin-Stimulated Map2 Kinase Antibody Produced In Rabbit; Anti-Map Kinase 1 Antibody Produced I |
Brand | SIGMA-ALDRICH |
Tiered Pricing - HPA003995-100UL
Qty | Discount | Price |
---|---|---|
4+ | 5% | £407.55 |
12+ | 6% | £403.26 |
Properties
Property | Value |
---|---|
eCl@ss | 32160000 |
Shipped on ICE | WICE |
UNSPSC Code | 12350000 |
ADRSuff | 1 |
Storage Temperature | -20C |
Flash Point | Not applicable |
GHS Categories | NH |
GHS Hazard Codes | NH |
GHS Hazard Statements | NH |
GHS Pictograms | - |
GHS Precaution Codes | - |
GHS Signal Words | - |
MDL Number | MFCD02179320 |
Net Weight | 100 |
Synonyms | Anti-ERK-1 antibody produced in rabbit; Anti-ERT2 antibody produced in rabbit; Anti-Extracellular signal-regulated kinase 1 antibody produced in rabbit; Anti-Insulin-stimulated MAP2 kinase antibody produced in rabbit; Anti-MAP kinase 1 antibody produced i |
Tariff Number | 30021500900 |
UniProt accession no. | P27361 |
clone | polyclonal |
Antibody Form | affinity isolated antibody |
product line | Prestige Antibodies(R) Powered by Atlas Antibodies |
packaging | antibody small pack of 25 muL |
Gene Information | human ... MAPK3(5595) |
technique(s) | immunohistochemistry: 1:20- 1:50 |
storage temp. | -20C |
Quality Level | 100 |
shipped in | wet ice |
Antibody Product Type | primary antibodies |
biological source | rabbit |
conjugate | unconjugated |
form | buffered aqueous glycerol solution |
immunogen sequence | YVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPV |
species reactivity | human |
Description
Anti-Mapk3