Click to Zoom

Anti-Muc5B

From £428.64 per (ex VAT)

Anti-Muc5B

Product Code HPA008246-100UL
Unit of Measure 1X100UL
Synonyms Anti-Cervical Mucin; Anti-High Molecular Weight Salivary Mucin Mg1; Anti-Muc-5B; Anti-Mucin-5 Subtype B, Tracheobronchial; Anti-Mucin-5B Precursor; Anti-Sublingual Gland Mucin
Brand SIGMA-ALDRICH

Tiered Pricing - HPA008246-100UL

Qty Discount Price
4+ 5% £433.20
12+ 6% £428.64
SKU - Pack Size Availability Price (ex VAT) Qty
HPA008246-25UL Anti-Muc5B Please check stock availability Check Availability £217.00
HPA008246-100UL Please check stock availability Check Availability £0.00 per EA £456.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms Anti-Cervical mucin; Anti-High molecular weight salivary mucin MG1; Anti-MUC-5B; Anti-Mucin-5 subtype B, tracheobronchial; Anti-Mucin-5B precursor; Anti-Sublingual gland mucin
Tariff Number 30021500900
technique(s) immunohistochemistry: 1:500-1:1000
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
packaging antibody small pack of 25 muL
storage temp. -20C
Quality Level 100
immunogen sequence CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
shipped in wet ice
Antibody Product Type primary antibodies
biological source rabbit
conjugate unconjugated
enhanced validation orthogonal RNAseqLearn more about Antibody Enhanced Validation
form buffered aqueous glycerol solution
UniProt accession no. Q9HC84
species reactivity human
Gene Information human ... MUC5B(727897)

Description

Anti-Muc5B

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA