Click to Zoom

Anti-Ncaph2

From £428.64 per (ex VAT)

Anti-Ncaph2

Product Code HPA067932-100UL
Unit of Measure 1X100UL
Synonyms 384D8-2; Cap-H2; Hcap-H2
Brand SIGMA-ALDRICH

Tiered Pricing - HPA067932-100UL

Qty Discount Price
4+ 5% £433.20
12+ 6% £428.64
SKU - Pack Size Availability Price (ex VAT) Qty
HPA067932-100UL Please check stock availability Check Availability £0.00 per EA £456.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
Storage Temperature -20C
Flash Point Not applicable
GHS Categories Skin Irrit. 2,Eye Irrit. 2
GHS Hazard Codes H315-H319
GHS Hazard Statements Causes skin irritation. Causes serious eye irritation.
GHS Pictograms GHS07
GHS Precaution Codes P305 + P351 + P338
GHS Signal Words Warning
Net Weight 100
Synonyms 384D8-2; CAP-H2; hCAP-H2
Tariff Number 30021500900
immunogen sequence AAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEG
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
UniProt accession no. Q6IBW4
packaging antibody small pack of 25 muL
Gene Information human ... NCAPH2(29781)
technique(s) immunofluorescence: 0.25-2 mug/mL
storage temp. -20C
Quality Level 100
enhanced validation RNAi knockdownLearn more about Antibody Enhanced Validation
shipped in wet ice
Antibody Product Type primary antibodies
biological source rabbit
conjugate unconjugated
form buffered aqueous glycerol solution
species reactivity human

Description

Anti-Ncaph2

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA