Click to Zoom

Anti-Sec23B

From £454.96 per (ex VAT)

Anti-Sec23B

Product Code HPA008216-100UL
Unit of Measure 1X100UL
Synonyms Anti-Protein Transport Protein Sec23B Antibody Produced In Rabbit; Anti-Sec23-Related Protein B Antibody Produced In Rabbit
Brand SIGMA-ALDRICH

Tiered Pricing - HPA008216-100UL

Qty Discount Price
4+ 5% £459.80
12+ 6% £454.96
SKU - Pack Size Availability Price (ex VAT) Qty
HPA008216-100UL Please check stock availability Check Availability £0.00 per EA £484.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms Anti-Protein transport protein Sec23B antibody produced in rabbit; Anti-SEC23-related protein B antibody produced in rabbit
Tariff Number 30021500900
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
packaging antibody small pack of 25 muL
technique(s) immunofluorescence: 0.25-2 mug/mL
storage temp. -20C
Quality Level 100
shipped in wet ice
Antibody Product Type primary antibodies
Gene Information human ... SEC23B(10483)
biological source rabbit
conjugate unconjugated
UniProt accession no. Q15437
immunogen sequence MVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGV
form buffered aqueous glycerol solution
species reactivity mouse, rat, human

Description

Anti-Sec23B

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA