Click to Zoom

Anti-Ndfip1

From £454.96 per (ex VAT)

Anti-Ndfip1

Product Code HPA009682-100UL
Unit of Measure 1X100UL
Synonyms Anti-Breast Cancer-Associated Protein Sga-1M Antibody Produced In Rabbit; Anti-Nedd4 Ww Domain-Binding Protein 5 Antibody Produced In Rabbit; Anti-Nedd4 Family-Interacting Protein 1 Antibody Produced In Rabbit; Anti-Putative Mapk-Activating Protein Pm13 A
Brand SIGMA-ALDRICH

Tiered Pricing - HPA009682-100UL

Qty Discount Price
4+ 5% £459.80
12+ 6% £454.96
SKU - Pack Size Availability Price (ex VAT) Qty
HPA009682-100UL Please check stock availability Check Availability £0.00 per EA £484.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms Anti-Breast cancer-associated protein SGA-1M antibody produced in rabbit; Anti-NEDD4 WW domain-binding protein 5 antibody produced in rabbit; Anti-NEDD4 family-interacting protein 1 antibody produced in rabbit; Anti-Putative MAPK-activating protein PM13 a
Tariff Number 30021500900
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
technique(s) immunohistochemistry: 1:20-1:50
storage temp. -20C
Quality Level 100
Gene Information human ... NDFIP1(80762)
shipped in wet ice
Antibody Product Type primary antibodies
biological source rabbit
conjugate unconjugated
form buffered aqueous glycerol solution
UniProt accession no. Q9BT67
species reactivity human
immunogen sequence SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP

Description

Anti-Ndfip1

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA