Click to Zoom

Anti-Cfap44 Antibody Produced In Rabbit

From £454.96 per (ex VAT)

Anti-Cfap44 Antibody Produced In Rabbit

Product Code HPA067258-100UL
Unit of Measure 1X100UL
Synonyms Anti-Flj11142; Anti-Wdr52
Brand SIGMA-ALDRICH

Tiered Pricing - HPA067258-100UL

Qty Discount Price
4+ 5% £459.80
12+ 6% £454.96
SKU - Pack Size Availability Price (ex VAT) Qty
HPA067258-100UL Please check stock availability Check Availability £0.00 per EA £484.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms Anti-FLJ11142; Anti-WDR52
Tariff Number 30021500900
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
immunogen sequence HSFGYDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGVHPHKTYFTVAEKGSFPDIIIYEYPSLRPYRVLRDGTEKG
packaging antibody small pack of 25 muL
storage temp. -20C
Quality Level 100
shipped in wet ice
Antibody Product Type primary antibodies
technique(s) immunohistochemistry: 1:200- 1:500
biological source rabbit
Gene Information human ... WDR52(55779)
conjugate unconjugated
form buffered aqueous glycerol solution
species reactivity human

Description

Anti-Cfap44 Antibody Produced In Rabbit

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA