Click to Zoom

Anti-Rbm10

From £421.12 per (ex VAT)

Anti-Rbm10

Product Code HPA034972-100UL
Unit of Measure 1X100UL
Synonyms Anti-Dxs8237E; Anti-Gpatc9; Anti-Gpatch9; Anti-Kiaa0122; Anti-Rna Binding Motif Protein 10; Anti-Zranb5
Brand SIGMA-ALDRICH

Tiered Pricing - HPA034972-100UL

Qty Discount Price
4+ 5% £425.60
12+ 6% £421.12
SKU - Pack Size Availability Price (ex VAT) Qty
HPA034972-100UL Please check stock availability Check Availability £0.00 per EA £448.00
Sub-Total £0.00 (ex VAT)
Add to Favourites

Properties

Property Value
eCl@ss 32160000
Shipped on ICE WICE
UNSPSC Code 12350000
ADRSuff 1
Storage Temperature -20C
Flash Point Not applicable
GHS Categories NH
GHS Hazard Codes NH
GHS Hazard Statements NH
GHS Pictograms -
GHS Precaution Codes -
GHS Signal Words -
Net Weight 100
Synonyms Anti-DXS8237E; Anti-GPATC9; Anti-GPATCH9; Anti-KIAA0122; Anti-RNA binding motif protein 10; Anti-ZRANB5
Tariff Number 30021500900
technique(s) immunohistochemistry: 1:500-1:1000
clone polyclonal
Antibody Form affinity isolated antibody
product line Prestige Antibodies(R) Powered by Atlas Antibodies
UniProt accession no. P98175
packaging antibody small pack of 25 muL
immunogen sequence MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRR
Gene Information human ... RBM10(8241)
storage temp. -20C
Quality Level 100
enhanced validation RNAi knockdownLearn more about Antibody Enhanced Validation
shipped in wet ice
Antibody Product Type primary antibodies
biological source rabbit
conjugate unconjugated
form buffered aqueous glycerol solution
species reactivity human

Description

Anti-Rbm10

Data Sheets

Safety Data Sheet

Request SDS

Certificate of Analysis

Request COA