01904 488599
Anti-Mief2 Antibody Produced In Rabbit
From £498.00 per (ex VAT)
Anti-Mief2 Antibody Produced In Rabbit
| Product Code | HPA042334-100UL |
|---|---|
| Unit of Measure | 1X100UL |
| Synonyms | Anti-Mgc23130; Anti-Mid49; Anti-Smcr7 |
| Brand | SIGMA-ALDRICH |
Properties
| Property | Value |
|---|---|
| eCl@ss | 32160000 |
| Shipped on ICE | WICE |
| UNSPSC Code | 12350000 |
| ADRSuff | 1 |
| Storage Temperature | -20C |
| Flash Point | Not applicable |
| GHS Categories | NH |
| GHS Hazard Codes | NH |
| GHS Hazard Statements | NH |
| GHS Pictograms | - |
| GHS Precaution Codes | - |
| GHS Signal Words | - |
| Net Weight | 100 |
| Synonyms | Anti-MGC23130; Anti-MiD49; Anti-SMCR7 |
| Tariff Number | 30021500900 |
| clone | polyclonal |
| Antibody Form | affinity isolated antibody |
| product line | Prestige Antibodies(R) Powered by Atlas Antibodies |
| Gene Information | human ... SMCR7(125170) |
| packaging | antibody small pack of 25 muL |
| storage temp. | -20C |
| Quality Level | 100 |
| immunogen sequence | PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL |
| shipped in | wet ice |
| Antibody Product Type | primary antibodies |
| biological source | rabbit |
| conjugate | unconjugated |
| technique(s) | immunohistochemistry: 1:50- 1:200 |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
Description
Anti-Mief2 Antibody Produced In Rabbit